PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022391t1
Common NameTCM_022391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 221aa    MW: 25833.2 Da    PI: 8.5822
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022391t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1960113356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+ ++t++ql+ Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Thecc1EG022391t1  60 KKKRLTTDQLDSLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWK 113
                       56779************************************************9 PP

2HD-ZIP_I/II118.82.8e-3859150192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekk+rl+++q+ +LE+sF+ee kL+p+rK++l+reLglqprq+avWFqnrRAR+k+kqlE+ y+aLk++yd +++e+++L++ev +L+  l+
  Thecc1EG022391t1  59 EKKKRLTTDQLDSLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWKAKQLERLYDALKQEYDVISREKQKLQEEVMKLKGMLR 150
                       69*************************************************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1851117IPR009057Homeodomain-like
PROSITE profilePS5007117.45955115IPR001356Homeobox domain
SMARTSM003897.3E-1758119IPR001356Homeobox domain
PfamPF000462.1E-1660113IPR001356Homeobox domain
CDDcd000861.25E-1560116No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2065114IPR009057Homeodomain-like
PRINTSPR000313.8E-58695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000313.8E-595111IPR000047Helix-turn-helix motif
PfamPF021836.1E-9115149IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MDWNGTLRTF VSRPEPSLNF LYNYNYDQYP GMEMKHPGLV EAVHGLVPAL DKNSYNNQEK  60
KKRLTTDQLD SLERSFQEEI KLDPDRKMKL SRELGLQPRQ IAVWFQNRRA RWKAKQLERL  120
YDALKQEYDV ISREKQKLQE EVMKLKGMLR EQATKNPGST GYTDMSGEET VESTSIRCSN  180
KPRVVANHHH QIAECNYVFN VDEYNPISSP YWAVQLPSYP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027573.11e-166Homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR07e-59ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A061ESP91e-166A0A061ESP9_THECC; Homeobox-leucine zipper protein ATHB-51
STRINGVIT_08s0007g04200.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.14e-60homeobox 51
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Zhao JL, et al.
    Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus.
    J Integr Plant Biol, 2015. 57(11): p. 925-35
    [PMID:25735194]